Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

vesicle amine transport protein 1 homolog (T. californica), Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant VAT1.

Manufacturer:  Abnova Corporation H00010493A01

Catalog No. 89-004-496


Add to cart

Description

Description

Synaptic vesicles are responsible for regulating the storage and release of neurotransmitters in the nerve terminal. The protein encoded by this gene is an abundant integral membrane protein of cholinergic synaptic vesicles and is thought to be involved in vesicular transport. It belongs to the quinone oxidoreductase subfamily of zinc-containing alcohol dehydrogenase proteins. [provided by RefSeq

Sequence: PKRNLMALARTWWNQFSVTALQLLQANRAVCGFHLGYLDGEVELVSGVVARLLALYNQGHIKPHIDSVWPFEKVADAMKQMQEKKNVGKVLLVPGPEKE
Specifications

Specifications

vesicle amine transport protein 1 homolog (T. californica)
Unconjugated
50% glycerol
NM_006373
FLJ20230|VATI
Mouse
50 uL
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Primary
10493
ELISA, Western Blot
Mouse polyclonal antibody raised against a partial recombinant VAT1.
VAT1
Serum
VAT1
VAT1 (NP_006364, 294 a.a. ~ 392 a.a) partial recombinant protein with GST tag.
RUO
Y
Polyclonal
Human
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit