vav 1 guanine nucleotide exchange factor, Mouse, Clone: 1A6, Abnova™

Catalog No.	Quantity
89-001-046	100 μg

Catalog No. 89-001-046 Supplier Abnova Corporation Supplier No. H00007409M02

Description

Mouse monoclonal antibody raised against a partial recombinant VAV1.

The protein encoded by this proto-oncogene is a member of the Dbl family of guanine nucleotide exchange factors (GEF) for the Rho family of GTP binding proteins. The protein is important in hematopoiesis, playing a role in T-cell and B-cell development and activation. This particular GEF has been identified as the specific binding partner of Nef proteins from HIV-1. Coexpression and binding of these partners initiates profound morphological changes, cytoskeletal rearrangements and the JNK/SAPK signaling cascade, leading to increased levels of viral transcription and replication. [provided by RefSeq

Sequence: RGLTELVEFYQQNSLKDCFKSLDTTLQFPFKEPEKRTISRPAVGSTKYFGTAKARYDFCARDRSELSLKEGDIIKILNKKGQQGWWRGEIYGRVGWFPANYVEEDYSEYC

Specifications

• Antigen: vav 1 guanine nucleotide exchange factor
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 1A6
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant VAV1.
• Formulation: PBS with no preservative; pH 7.4
• Gene: VAV1
• Gene Accession No.: BC013361
• Gene Alias: VAV
• Gene Symbols: VAV1
• Host Species: Mouse
• Immunogen: VAV1 (AAH13361, 681 a.a. ∼ 790 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Research Discipline: Signal Transduction
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 7409
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG2a κ