VCP, Mouse, Clone: 2H5, Abnova™

Catalog No.	Quantity
89-002-719	100 μg

Catalog No. 89-002-719 Supplier Abnova Corporation Supplier No. H00007415M15

Description

Mouse monoclonal antibody raised against a partial recombinant VCP.

The protein encoded by this gene is a member of a family that includes putative ATP-binding proteins involved in vesicle transport and fusion, 26S proteasome function, and assembly of peroxisomes. This protein, as a structural protein, is associated with clathrin, and heat-shock protein Hsc70, to form a complex. It has been implicated in a number of cellular events that are regulated during mitosis, including homotypic membrane fusion, spindle pole body function, and ubiquitin-dependent protein degradation. [provided by RefSeq

Sequence: IHTKNMKLADDVDLEQVANETHGHVGADLAALCSEAALQAIRKKMDLIDLEDETIDAEVMNSLAVTMDDFRWALSQSNPSALRETVVEVP

Specifications

• Antigen: VCP,
• Applications: ELISA, Immunofluorescence, Western Blot
• Classification: Monoclonal
• Clone: 2H5
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant VCP.
• Formulation: PBS with no preservative; pH 7.4
• Gene: VCP
• Gene Accession No.: BC007562
• Gene Alias: IBMPFD/MGC131997/MGC148092/MGC8560/TERA/p97
• Gene Symbols: VCP
• Host Species: Mouse
• Immunogen: VCP (AAH07562.2, 221 a.a. ∼ 310 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 7415
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG2a κ