Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

VCP, Mouse, Clone: 2H5, Abnova™

Catalog No. 89002719 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-002-719 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-002-719 Supplier Abnova Corporation Supplier No. H00007415M15
Add to Cart
Add to Cart

Mouse monoclonal antibody raised against a partial recombinant VCP.

The protein encoded by this gene is a member of a family that includes putative ATP-binding proteins involved in vesicle transport and fusion, 26S proteasome function, and assembly of peroxisomes. This protein, as a structural protein, is associated with clathrin, and heat-shock protein Hsc70, to form a complex. It has been implicated in a number of cellular events that are regulated during mitosis, including homotypic membrane fusion, spindle pole body function, and ubiquitin-dependent protein degradation. [provided by RefSeq

Sequence: IHTKNMKLADDVDLEQVANETHGHVGADLAALCSEAALQAIRKKMDLIDLEDETIDAEVMNSLAVTMDDFRWALSQSNPSALRETVVEVP

Specifications

Antigen VCP,
Applications ELISA, Immunofluorescence, Western Blot
Classification Monoclonal
Clone 2H5
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant VCP.
Formulation PBS with no preservative; pH 7.4
Gene VCP
Gene Accession No. BC007562
Gene Alias IBMPFD/MGC131997/MGC148092/MGC8560/TERA/p97
Gene Symbols VCP
Host Species Mouse
Immunogen VCP (AAH07562.2, 221 a.a. ∼ 310 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 7415
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Liquid
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.