vasoactive intestinal peptide receptor 2, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant VIPR2.

Supplier:  Abnova Corporation H00007434A01

Catalog No. 89-004-363

Description

Vasoactive intestinal peptide (VIP; MIM 192320) and pituitary adenylate cyclase activating polypeptide (PACAP; MIM 102980) are homologous peptides that function as neurotransmitters and neuroendocrine hormones. While the receptors for VIP and PACAP share homology, they differ in their substrate specificities and expression patterns. See VIPR1 (MIM 192321) and ADCYAP1R1(MIM 102981).[supplied by OMIM

Sequence: ECRFHLEIQEEETKCAELLRSQTEKHKACSGVWDNITCWRPANVGETVTVPCPKVFSNFYSKAGNISKNCTSDGWSETFPDFVDACGYSDPEDESKITFYILV

Specifications

• Antigen: vasoactive intestinal peptide receptor 2
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a partial recombinant VIPR2.
• Gene: VIPR2
• Gene Alias: FLJ16511/VPAC2/VPCAP2R
• Host Species: Mouse
• Quantity: 50 μL
• Research Discipline: Membrane Receptors
• Primary or Secondary: Primary
• Target Species: Human
• Form: Serum

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: NM_003382
• Gene Symbols: VIPR2
• Immunogen: VIPR2 (NP_003373, 24 a.a. ∼ 126 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Whole Molecule: Yes
• Gene ID (Entrez): 7434
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.