vanin 3, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-004-664	50 μL

Catalog No. 89-004-664 Supplier Abnova Corporation Supplier No. H00055350A01

Description

Mouse polyclonal antibody raised against a partial recombinant VNN3.

This gene is the central gene in a cluster of three vanin genes on chromosome 6q23-q24. The open reading frame is disrupted by a frameshift, and all splice variants that have been described are candidates for nonsense-mediated decay (NMD). Consequently, it is unlikely that this gene expresses a protein in vivo, so it is classified as a pseudogene. Extensive alternative splicing has been described; the two most common variants are represented as RefSeqs. [provided by RefSeq

Sequence: ARYHKYNLFAPEIQFDFPKDSELVTFDTPFGKFGIFTCFDIFSHDPAVVVVDEFQLTAFSTPQHGTTRCPSSRLFPSIQHGPRPWESIYLLQIPTTPACT

Specifications

• Antigen: vanin 3
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant VNN3.
• Formulation: 50% glycerol
• Gene: VNN3
• Gene Accession No.: NM_018399
• Gene Alias: HSA238982/MGC171203/PAGEL-beta/PAGEL-eta/PAGEL-zeta
• Gene Symbols: VNN3
• Host Species: Mouse
• Immunogen: VNN3 (NP_060869.2, 175 a.a. ∼ 274 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 55350
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Serum