visinin-like 1, Mouse, Clone: 2F1-E3, Abnova™

Catalog No.	Quantity
89-014-212	100 μg

Catalog No. 89-014-212 Supplier Abnova Corporation Supplier No. H00007447M01

Description

Mouse monoclonal antibody raised against a full-length recombinant VSNL1.

This gene is a member of the visinin/recoverin subfamily of neuronal calcium sensor proteins. The encoded protein is strongly expressed in granule cells of the cerebellum where it associates with membranes in a calcium-dependent manner and modulates intracellular signaling pathways of the central nervous system by directly or indirectly regulating the activity of adenylyl cyclase. Alternatively spliced transcript variants have been observed, but their full-length nature has not been determined. [provided by RefSeq

Sequence: MGKQNSKLAPEVMEDLVKSTEFNEHELKQWYKGFLKDCPSGRLNLEEFQQLYVKFFPYGDASKFAQHAFRTFDKNGDGTIDFREFICALSITSRGSFEQKLNWAFNMYDLDGDGKITRVEMLEIIEAIYKMVGTVIMMKMNEDGLTPEQRVDKIFSKMDKNKDDQITLDEFKEAAKSDPSIVLLLQCDIQK

Specifications

• Antigen: visinin-like 1
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 2F1-E3
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a full length recombinant VSNL1.
• Formulation: PBS with no preservative; pH 7.4
• Gene: VSNL1
• Gene Accession No.: BC022012
• Gene Alias: HLP3/HPCAL3/HUVISL1/VILIP/VILIP-1
• Gene Symbols: VSNL1
• Host Species: Mouse
• Immunogen: VSNL1 (AAH22012, 1 a.a. ∼ 191 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Research Discipline: Stem Cell Biology
• Primary or Secondary: Primary
• Gene ID (Entrez): 7447
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG2a κ