WD repeat domain 5, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-004-532	50 μL

Catalog No. 89-004-532 Supplier Abnova Corporation Supplier No. H00011091A01

Description

Mouse polyclonal antibody raised against a partial recombinant WDR5.

This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This protein contains 7 WD repeats. Alternatively spliced transcript variants encoding the same protein have been identified. [provided by RefSeq

Sequence: QPTPSSSATQSKPTPVKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGK

Specifications

• Antigen: WD repeat domain 5
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant WDR5.
• Formulation: 50% glycerol
• Gene: WDR5
• Gene Accession No.: NM_017588
• Gene Alias: BIG-3/SWD3
• Gene Symbols: WDR5
• Host Species: Mouse
• Immunogen: WDR5 (NP_060058, 16 a.a. ∼ 120 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 11091
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Serum