WNT inhibitory factor 1, Rabbit, Purified MaxPab™ Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against a full-length human WIF1 protein.

Manufacturer: Abnova Corporation H00011197D01P

Catalog No. 89-018-073

  Check Availability
Add to Cart

    Specifications

    Antigen WNT inhibitory factor 1
    Applications Western Blotting
    Conjugate Unlabeled
    Cross Reactivity Human
    Description WNT inhibitory factor 1
    Format Affinity Purified
    Formulation In 1X PBS, pH 7.4
    Gene WIF1
    Gene Accession No. BC018037
    Gene Alias WIF-1
    Gene Symbols WIF1
    Host Species Rabbit
    Immunogen WIF1 (AAH18037.1, 1 a.a. ∽379 a.a) full-length human protein.
    Purification Method Protein A column
    Quantity 100μg
    Regulatory Status RUO
    Research Discipline Signal Transduction
    Species Reactivity Human
    Storage Requirements Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
    Primary or Secondary Primary
    Monoclonal or Polyclonal Polyclonal
    Gene ID (Entrez) 11197

    WNT proteins are extracellular signaling molecules involved in the control of embryonic development. This gene encodes a secreted protein, which binds WNT proteins and inhibits their activities. This protein contains a WNT inhibitory factor (WIF) domain and 5 epidermal growth factor (EGF)-like domains. It may be involved in mesoderm segmentation. This protein is found to be present in fish, amphibia and mammals. [provided by RefSeq

    Sequence: MARRSAFPAAALWLWSILLCLLALRAEAGPPQEESLYLWIDAHQARVLIGFEEDILIVSEGKMAPFTHDFRKAQQRMPAIPVNIHSMNFTWQAAGQAEYFYEFLSLRSLDKGIMADPTVNVPLLGTVPHKASVVQVGFPCLGKQDGVAAFEVDVIVMNSEGNTILKTPQNAIFFKTCQQAECPGGCRNGGFCNERRICECPDGFHGPHCEKALCTPRCMNGGLCVTPGFCICPPGFYGVNCDKANCSTTCFNGGTCFYPGKCICPPGLEGEQCEISKCPQPCRNGGKCIGKSKCKCSKGYQGDLCSKPVCEPGCGAHGTCHEPNKCQCQEGWHGRHCNKRYEASLIHALRPAGAQLRQHTPSLKKAEERRDPPESNYIW

  • Description & Specifications

Related Products


Product Content Feedback

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit