WRB, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant WRB.

Supplier:  Abnova Corporation H00007485A01

Catalog No. 89-003-099

Description

This gene encodes a basic nuclear protein of unknown function. The gene is widely expressed in adult and fetal tissues. Since the region proposed to contain the gene(s) for congenital heart disease (CHD) in Down syndrome (DS) patients has been restricted to 21q22.2-22.3, this gene, which maps to 21q22.3, has a potential role in the pathogenesis of Down syndrome congenital heart disease. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq

Sequence: PSFSSFMSRVLQKDAEQESQMRAEIQDMKQELSTVNMMDEFARYARLERKINKMTDKLKTHVKARTAQLAKIK

Specifications

• Antigen: WRB
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a partial recombinant WRB.
• Gene: WRB
• Gene Alias: CHD5
• Host Species: Mouse
• Quantity: 50 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Liquid

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: NM_004627
• Gene Symbols: WRB
• Immunogen: WRB (NP_004618, 29 a.a. ∼ 101 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Gene ID (Entrez): 7485
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.