WRB, Mouse, Clone: 4D6, Abnova™

Catalog No.	Quantity
89-002-721	100 μg

Catalog No. 89-002-721 Supplier Abnova Corporation Supplier No. H00007485M05

Description

Mouse monoclonal antibody raised against a partial recombinant WRB.

This gene encodes a basic nuclear protein of unknown function. The gene is widely expressed in adult and fetal tissues. Since the region proposed to contain the gene(s) for congenital heart disease (CHD) in Down syndrome (DS) patients has been restricted to 21q22.2-22.3, this gene, which maps to 21q22.3, has a potential role in the pathogenesis of Down syndrome congenital heart disease. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq

Sequence: PSFSSFMSRVLQKDAEQESQMRAEIQDMKQELSTVNMMDEFARYARLERKINKMTDKLKTHVKARTAQLAKIK

Specifications

• Antigen: WRB,
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 4D6
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant WRB.
• Formulation: PBS with no preservative; pH 7.4
• Gene: WRB
• Gene Accession No.: NM_004627
• Gene Alias: CHD5
• Gene Symbols: WRB
• Host Species: Mouse
• Immunogen: WRB (NP_004618, 29 a.a. ∼ 101 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 7485
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG2a κ