Wilms tumor 1, Mouse, Clone: 2H4, Abnova™

Catalog No.	Quantity
89-001-048	100 μg

Catalog No. 89-001-048 Supplier Abnova Corporation Supplier No. H00007490M01

Description

Mouse monoclonal antibody raised against a full-length recombinant WT1.

This gene encodes a transcription factor that contains four zinc-finger motifs at the C-terminus and a proline/glutamine-rich DNA-binding domain at the N-terminus. It has an essential role in the normal development of the urogenital system, and it is mutated in a small subset of patients with Wilm's tumors. Multiple transcript variants, resulting from alternative splicing at two coding exons, have been well characterized. There is also evidence for the use of non-AUG (CUG) translation initiation site upstream of, and in-frame with the first AUG, leading to additional isoforms. Authors of PMID:7926762 also provide evidence that WT1 mRNA undergoes RNA editing in human and rat, and that this process is tissue-restricted and developmentally regulated. [provided by RefSeq]

Sequence: QDVRRVPGVAPTLVRSASETSEKRPFMCAYPGCNKRYFKLSHLQMHSRKHTGEKPYQCDFKDCERRFSRSDQLKRHQRRHTGVKPFQCKTC

Specifications

• Antigen: Wilms tumor 1
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 2H4
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a full length recombinant WT1.
• Formulation: PBS with no preservative; pH 7.4
• Gene: WT1
• Gene Accession No.: NM_000378
• Gene Alias: GUD/WAGR/WIT-2/WT33
• Gene Symbols: WT1
• Host Species: Mouse
• Immunogen: WT1 (NP_000369.3, 349 a.a. ∼ 439 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Research Discipline: Cell Cycle
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 7490
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG2b κ