WWOX, Mouse, Purified MaxPab™ Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-002-845	50 μg

Catalog No. 89-002-845 Supplier Abnova Corporation Supplier No. H00051741B01P

Description

Mouse polyclonal antibody raised against a full-length human WWOX protein.

WW domain-containing proteins are found in all eukaryotes and play an important role in the regulation of a wide variety of cellular functions such as protein degradation, transcription, and RNA splicing. This gene encodes a protein which contains 2 WW domains and a short-chain dehydrogenase/reductase domain (SRD). The highest normal expression of this gene is detected in hormonally regulated tissues such as testis, ovary, and prostate. This expression pattern and the presence of an SRD domain suggest a role for this gene in steroid metabolism. The encoded protein is more than 90% identical to the mouse protein, which is an essential mediator of tumor necrosis factor-alpha-induced apoptosis, suggesting a similar, important role in apoptosis for the human protein. In addition, there is evidence that this gene behaves as a suppressor of tumor growth. Alternative splicing of this gene generates transcript variants that encode different isoforms. [provided by RefSeq

Sequence: MAALRYAGLDDTDSEDELPPGWEERTTKDGWVYYANHTEEKTQWEHPKTGKRKRVAGDLPYGWEQETDENGQVFFVDHINKRTTYLDPRLAFTVDDNPTKPTTRQRYDGSTTAMEILQGRDFTGKVVVVTGANSGIGFETAKSFALHGAHVILACRNMARASEAVSRILEEWKTKYHPPPEKCRIKIFH

Specifications

• Antigen: WWOX
• Applications: Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a full-length human WWOX protein.
• Formulation: PBS with no preservative; pH 7.4
• Gene: WWOX
• Gene Accession No.: NM_130791.1
• Gene Alias: D16S432E/FOR/FRA16D/HHCMA56/PRO0128/SDR41C1/WOX1
• Gene Symbols: WWOX
• Host Species: Mouse
• Immunogen: WWOX (NP_570607.1, 1 a.a. ∼ 189 a.a) full-length human protein.
• Purification Method: Affinity chromatography
• Quantity: 50 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 51741
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Purified
• Isotype: IgG