Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

WW domain containing E3 ubiquitin protein ligase 1, Mouse, Clone: 1A7, Abnova™

Catalog No. 89014275 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-014-275 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-014-275 Supplier Abnova Corporation Supplier No. H00011059M01
Add to Cart
Add to Cart

Mouse monoclonal antibody raised against a partial recombinant WWP1.

WW domain-containing proteins are found in all eukaryotes and play an important role in the regulation of a wide variety of cellular functions such as protein degradation, transcription, and RNA splicing. This gene encodes a protein which contains 4 tandem WW domains and a HECT (homologous to the E6-associated protein carboxyl terminus) domain. The encoded protein belongs to a family of NEDD4-like proteins, which are E3 ubiquitin-ligase molecules and regulate key trafficking decisions, including targeting of proteins to proteosomes or lysosomes. Alternative splicing of this gene generates at least 6 transcript variants; however, the full length nature of these transcripts has not been defined. [provided by RefSeq

Sequence: CSSSPTIEIQENGDALHENGEPSARTTARLAVEGTNGIDNHVPTSTLVQNSCCSYVVNGDNTPSSPSQVAARPKNTPAPKPLASEPADDTVNGESSSFAPTDNASVTGT

Specifications

Antigen WW domain containing E3 ubiquitin protein ligase 1
Applications ELISA, Immunofluorescence, Immunohistochemistry (PFA fixed), Immunoprecipitation, Western Blot
Classification Monoclonal
Clone 1A7
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant WWP1.
Formulation PBS with no preservative; pH 7.4
Gene WWP1
Gene Accession No. NM_007013
Gene Alias AIP5/DKFZp434D2111/Tiul1/hSDRP1
Gene Symbols WWP1
Host Species Mouse
Immunogen WWP1 (NP_008944, 152 a.a. ∼ 260 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity Purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Ubiquitin/Proteasome
Primary or Secondary Primary
Gene ID (Entrez) 11059
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.