X antigen family, member 2, Mouse, Purified MaxPab™ Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-016-981	50 μg

Catalog No. 89-016-981 Supplier Abnova Corporation Supplier No. H00009502B01P

Description

Mouse polyclonal antibody raised against a full-length human XAGE2 protein.

This gene is a member of the XAGE subfamily, which belongs to the GAGE family. The GAGE genes are expressed in a variety of tumors and in some fetal and reproductive tissues. This gene is strongly expressed in normal testis, and in Ewing's sarcoma, rhabdomyosarcoma, a breast cancer and a germ cell tumor. The protein encoded by this gene shares a sequence similarity with other GAGE/PAGE proteins. Because of the expression pattern and the sequence similarity, this protein also belongs to a family of CT (cancer-testis) antigens. [provided by RefSeq]

Sequence: MSWRGRSTYRPRPRRSLQPPELIGAMLEPTDEEPKEEKPPTKSRNPTPDQKREDDQGAAEIQVPDLEADLQELCQTKTGDGCEGGTDVKGKILPKAEHFKMPEAGEGKSQV

Specifications

• Antigen: X antigen family, member 2
• Applications: Immunofluorescence, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a full-length human XAGE2 protein.
• Formulation: PBS with no preservative; pH 7.4
• Gene: XAGE2
• Gene Accession No.: NM_130777.1
• Gene Alias: GAGED3/XAGE-2
• Gene Symbols: XAGE2
• Host Species: Mouse
• Immunogen: XAGE2 (NP_570133.1, 1 a.a. ∼ 111 a.a) full-length human protein.
• Purification Method: Affinity Purified
• Quantity: 50 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 9502
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG