Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89001050

YES1 (M02), Mouse anti-Human, Clone: 3C6, Abnova™

Catalog No. 89001050 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
50 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-001-050 50 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-001-050 Supplier Abnova Corporation Supplier No. H00007525M02
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a partial recombinant YES1.

This gene is the cellular homolog of the Yamaguchi sarcoma virus oncogene. The encoded protein has tyrosine kinase activity and belongs to the src family of proteins. This gene lies in close proximity to thymidylate synthase gene on chromosome 18, and a corresponding pseudogene has been found on chromosome 22. [provided by RefSeq

Sequence: MGCIKSKENKSPAIKYRPENTPEPVSTSVSHYGAEPTTVSPCPSSSAKGTAVNFSSLSMTPFGGSSGVTPFGGASSSFSV

Specifications

Antigen YES1
Applications ELISA, In situ PLA, Western Blot
Classification Monoclonal
Clone 3C6
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant YES1.
Formulation PBS with no preservative; pH 7.4
Gene YES1
Gene Accession No. BC048960
Gene Alias HsT441/P61-YES/Yes/c-yes
Gene Symbols YES1
Host Species Mouse
Immunogen YES1 (AAH48960, 1 a.a. ∼ 80 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity chromatography
Quantity 50 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 7525
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Liquid
Isotype IgG2b κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.