tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma polypeptide, Mouse, Clone: 3G3, Abnova™

Catalog No.	Quantity
89-001-052	100 μg

Catalog No. 89-001-052 Supplier Abnova Corporation Supplier No. H00007532M01

Description

Mouse monoclonal antibody raised against a partial recombinant YWHAG.

This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 100% identical to the rat ortholog. It is induced by growth factors in human vascular smooth muscle cells, and is also highly expressed in skeletal and heart muscles, suggesting an important role for this protein in muscle tissue. It has been shown to interact with RAF1 and protein kinase C, proteins involved in various signal transduction pathways. [provided by RefSeq

Sequence: EQKTSADGNEKKIEMVRAYREKIEKELEAVCQDVLSLLDNYLIKNCSETQYESKVFYLKMKGDYYRYLAEVATGEKRATVVESSEKAYSEAHEISKEHMQ

Specifications

• Antigen: tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma polypeptide
• Applications: ELISA
• Classification: Monoclonal
• Clone: 3G3
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant YWHAG.
• Formulation: PBS with no preservative; pH 7.4
• Gene: YWHAG
• Gene Accession No.: NM_012479
• Gene Alias: 14-3-3GAMMA
• Gene Symbols: YWHAG
• Host Species: Mouse
• Immunogen: YWHAG (NP_036611, 67 a.a. ∼ 166 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 7532
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG2a λ