YWHAZ, Mouse, Clone: 1B3, Abnova™

Catalog No.	Quantity
89-002-722	100 μg

Catalog No. 89-002-722 Supplier Abnova Corporation Supplier No. H00007534M04

Description

Mouse monoclonal antibody raised against a partial recombinant YWHAZ.

This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 99% identical to the mouse, rat and sheep orthologs. The encoded protein interacts with IRS1 protein, suggesting a role in regulating insulin sensitivity. Several transcript variants that differ in the 5' UTR but that encode the same protein have been identified for this gene. [provided by RefSeq]

Sequence: VVGARRSSWRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQ

Specifications

• Antigen: YWHAZ,
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 1B3
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant YWHAZ.
• Formulation: PBS with no preservative; pH 7.4
• Gene: YWHAZ
• Gene Accession No.: NM_003406.2
• Gene Alias: KCIP-1/MGC111427/MGC126532/MGC138156
• Gene Symbols: YWHAZ
• Host Species: Mouse
• Immunogen: YWHAZ (NP_003397.1, 51 a.a. ∼ 150 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 7534
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG1 κ