ZFHX3, Mouse, Clone: 3B1, Abnova™

Catalog No.	Quantity
89-016-232	100 μg

Catalog No. 89-016-232 Supplier Abnova Corporation Supplier No. H00000463M01

Description

Mouse monoclonal antibody raised against a partial recombinant ZFHX3.

This gene encodes a transcription factor with multiple homeodomains and zinc finger motifs, and regulates myogenic and neuronal differentiation. The encoded protein suppresses expression of the alpha-fetoprotein gene by binding to an AT-rich enhancer motif. The protein has also been shown to negatively regulate c-Myb, and transactivate the cell cycle inhibitor cyclin-dependent kinase inhibitor 1A (also known as p21CIP1). This gene is reported to function as a tumor suppressor in several cancers, and sequence variants of this gene are also associated with atrial fibrillation. Multiple transcript variants expressed from alternate promoters and encoding different isoforms have been found for this gene. [provided by RefSeq

Sequence: EDFESPSMSSVNLNFDQTKLDNDDCSSVNTAITDTTTGDEGNADNDSATGIATETKSSSAPNEGLTKAAMMAMSEYEDRLSSGLVSPAPSFYSKEYDNEG

Specifications

• Antigen: ZFHX3
• Applications: ELISA, Immunofluorescence, Western Blot
• Classification: Monoclonal
• Clone: 3B1
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant ZFHX3.
• Formulation: PBS with no preservative; pH 7.4
• Gene: ZFHX3
• Gene Accession No.: NM_006885
• Gene Alias: ATBF1/ATBT
• Gene Symbols: ZFHX3
• Host Species: Mouse
• Immunogen: ZFHX3 (NP_008816, 2811 a.a. ∼ 2910 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 463
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG1 κ