ZFP36L1, Mouse, Clone: 1A3, Abnova™

Catalog No.	Quantity
89-016-366	100 μg

Catalog No. 89-016-366 Supplier Abnova Corporation Supplier No. H00000677M02

Description

Mouse monoclonal antibody raised against a partial recombinant ZFP36L1.

This gene is a member of the TIS11 family of early response genes. Family members are induced by various agonists such as the phorbol ester TPA and the polypeptide mitogen EGF. The gene is well conserved across species and has a promoter that contains motifs seen in other early-response genes. The encoded protein contains a distinguishing putative zinc finger domain with a repeating cys-his motif. This putative nuclear transcription factor most likely functions in regulating the response to growth factors. [provided by RefSeq

Sequence: MTTTLVSATIFDLSEVLCKGNKMLNYSAPSAGGCLLDRKAVGTPAGGGFPRRHSVTLPSSKFHQNQLLSSLKGEPAPALSSRDSRFRDRSFSEGGERLLPTQKQPGGG

Specifications

• Antigen: ZFP36L1
• Applications: ELISA, KnockDown, Western Blot
• Classification: Monoclonal
• Clone: 1A3
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant ZFP36L1.
• Formulation: PBS with no preservative; pH 7.4
• Gene: ZFP36L1
• Gene Accession No.: NM_004926
• Gene Alias: BRF1/Berg36/ERF-1/ERF1/RNF162B/TIS11B/cMG1
• Gene Symbols: ZFP36L1
• Host Species: Mouse
• Immunogen: ZFP36L1 (NP_004917, 1 a.a. ∼ 108 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 677
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG1 κ