Zic family member 1 (odd-paired homolog, Drosophila), Mouse, Clone: 2D3, Abnova™

Mouse monoclonal antibody raised against a partial recombinant ZIC1.

Supplier:  Abnova Corporation H00007545M02

Catalog No. 89-001-053

Description

This gene encodes a member of the ZIC family of C2H2-type zinc finger proteins. Members of this family are important during development. Aberrant expression of this gene is seen in medulloblastoma, a childhood brain tumor. This gene is closely linked to the gene encoding zinc finger protein of the cerebellum 4, a related family member on chromosome 3. This gene encodes a transcription factor that can bind and transactivate the apolipoprotein E gene. [provided by RefSeq

Sequence: LLDAGPQYPAIGVTTFGASRHHSAGDVAERDVGLGINPFADGMGAFKLNPSSHELASAGQTAFTSQAPGYAAAAALGHHHHPGHVGSYSSAAFN

Specifications

• Antigen: Zic family member 1 (odd-paired homolog, Drosophila)
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_003412
• Gene Symbols: ZIC1
• Immunogen: ZIC1 (NP_003403, 2 a.a. ∼ 95 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Research Discipline: Signal Transduction
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody

• Applications: ELISA, Western Blot
• Clone: 2D3
• Description: Mouse monoclonal antibody raised against a partial recombinant ZIC1.
• Gene: ZIC1
• Gene Alias: ZIC/ZNF201
• Host Species: Mouse
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Whole Molecule: Yes
• Gene ID (Entrez): 7545
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG2a κ