Zic family member 3 (odd-paired homolog, Drosophila), Mouse, Clone: 4F7, Abnova™

Mouse monoclonal antibody raised against a full-length recombinant ZIC3.

Supplier:  Abnova Corporation H00007547M01

Catalog No. 89-001-055

Description

This gene encodes a member of the ZIC family of C2H2-type zinc finger proteins. This nuclear protein probably functions as a transcription factor in early stages of left-right body axis formation. Mutations in this gene cause X-linked visceral heterotaxy, which includes congenital heart disease and left-right axis defects in organs. [provided by RefSeq

Sequence: NQVHLGLRGELFGRADPYRPVASPRTDPYAAGAQFPNYSPMNMNMGVNVAAHHGPGAFFRYMRQPIKQELSCKWIDEAQLSRPKKSCDRTFST

Specifications

• Antigen: Zic family member 3 (odd-paired homolog, Drosophila)
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_003413
• Gene Symbols: ZIC3
• Immunogen: ZIC3 (NP_003404.1, 182 a.a. ∼ 274 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Whole Molecule: Yes
• Gene ID (Entrez): 7547
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG2a κ

• Applications: ELISA, Western Blot
• Clone: 4F7
• Description: Mouse monoclonal antibody raised against a full length recombinant ZIC3.
• Gene: ZIC3
• Gene Alias: HTX/HTX1/ZNF203
• Host Species: Mouse
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody