Zic family member 3 (odd-paired homolog, Drosophila), Mouse, Clone: 4F7, Abnova™

Catalog No.	Quantity
89-001-055	100 μg

Catalog No. 89-001-055 Supplier Abnova Corporation Supplier No. H00007547M01

Description

Mouse monoclonal antibody raised against a full-length recombinant ZIC3.

This gene encodes a member of the ZIC family of C2H2-type zinc finger proteins. This nuclear protein probably functions as a transcription factor in early stages of left-right body axis formation. Mutations in this gene cause X-linked visceral heterotaxy, which includes congenital heart disease and left-right axis defects in organs. [provided by RefSeq

Sequence: NQVHLGLRGELFGRADPYRPVASPRTDPYAAGAQFPNYSPMNMNMGVNVAAHHGPGAFFRYMRQPIKQELSCKWIDEAQLSRPKKSCDRTFST

Specifications

• Antigen: Zic family member 3 (odd-paired homolog, Drosophila)
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 4F7
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a full length recombinant ZIC3.
• Formulation: PBS with no preservative; pH 7.4
• Gene: ZIC3
• Gene Accession No.: NM_003413
• Gene Alias: HTX/HTX1/ZNF203
• Gene Symbols: ZIC3
• Host Species: Mouse
• Immunogen: ZIC3 (NP_003404.1, 182 a.a. ∼ 274 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 7547
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG2a κ