Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Zic family member 3 (odd-paired homolog, Drosophila), Mouse, Clone: 4F7, Abnova™

Catalog No. 89001055 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-001-055 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-001-055 Supplier Abnova Corporation Supplier No. H00007547M01
Add to Cart
Add to Cart

Mouse monoclonal antibody raised against a full-length recombinant ZIC3.

This gene encodes a member of the ZIC family of C2H2-type zinc finger proteins. This nuclear protein probably functions as a transcription factor in early stages of left-right body axis formation. Mutations in this gene cause X-linked visceral heterotaxy, which includes congenital heart disease and left-right axis defects in organs. [provided by RefSeq

Sequence: NQVHLGLRGELFGRADPYRPVASPRTDPYAAGAQFPNYSPMNMNMGVNVAAHHGPGAFFRYMRQPIKQELSCKWIDEAQLSRPKKSCDRTFST

Specifications

Antigen Zic family member 3 (odd-paired homolog, Drosophila)
Applications ELISA, Western Blot
Classification Monoclonal
Clone 4F7
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a full length recombinant ZIC3.
Formulation PBS with no preservative; pH 7.4
Gene ZIC3
Gene Accession No. NM_003413
Gene Alias HTX/HTX1/ZNF203
Gene Symbols ZIC3
Host Species Mouse
Immunogen ZIC3 (NP_003404.1, 182 a.a. ∼ 274 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity Purified
Quantity 100 μg
Regulatory Status RUO
Whole Molecule Yes
Primary or Secondary Primary
Gene ID (Entrez) 7547
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.