Zic family member 4, Mouse, Clone: 1A9, Abnova™

Catalog No.	Quantity
89-001-367	100 μg

Catalog No. 89-001-367 Supplier Abnova Corporation Supplier No. H00084107M05

Description

Mouse monoclonal antibody raised against a partial recombinant ZIC4.

This gene encodes a member of the ZIC family of C2H2-type zinc finger proteins. Members of this family are important during development, and have been associated with X-linked visceral heterotaxy and holoprosencephaly type 5. This gene is closely linked to the gene encoding zinc finger protein of the cerebellum 1, a related family member on chromosome 3. This gene encodes a protein of unknown function. [provided by RefSeq

Sequence: SDRKKHSHVHTSDKPYTCKVRGCDKCYTHPSSLRKHMKVHGRSPPPSSGYDSATPSALVSPSSDCGHKSQV

Specifications

• Antigen: Zic family member 4
• Applications: ELISA, Immunofluorescence, Immunohistochemistry (PFA fixed), Western Blot
• Classification: Monoclonal
• Clone: 1A9
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant ZIC4.
• Formulation: PBS with no preservative; pH 7.4
• Gene: ZIC4
• Gene Accession No.: NM_032153
• Gene Alias: FLJ42609/FLJ45833
• Gene Symbols: ZIC4
• Host Species: Mouse
• Immunogen: ZIC4 (NP_115529, 249 a.a. ∼ 319 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 84107
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG2a κ