zinc finger protein 207, Mouse, Clone: 6D7, Abnova™

Mouse monoclonal antibody raised against a partial recombinant ZNF207.

Supplier:  Abnova Corporation H00007756M06

Catalog No. 89-001-063

Description

Sequence: MGRKKKKQLKPWCWYCNRDFDDEKILIQHQKAKHFKCHICHKKLYTGPGLAIHCMQVHKETIDAVPNAIPGRTDIELEIYGMEGIPEKDMDERRRLLEQKTQESQKKKQQ

Specifications

• Antigen: zinc finger protein 207
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_003457
• Gene Symbols: ZNF207
• Immunogen: ZNF207 (NP_003448, 1 a.a. ∼ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Whole Molecule: Yes
• Gene ID (Entrez): 7756
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG2a κ

• Applications: ELISA, Immunofluorescence, Immunohistochemistry (PFA fixed), Western Blot
• Clone: 6D7
• Description: Mouse monoclonal antibody raised against a partial recombinant ZNF207.
• Gene: ZNF207
• Gene Alias: DKFZp761N202
• Host Species: Mouse
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody