Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

zinc finger protein 274, Mouse, Clone: 2F5, Abnova™

Catalog No. 89001192 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-001-192 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-001-192 Supplier Abnova Corporation Supplier No. H00010782M02
Add to Cart
Add to Cart

Mouse monoclonal antibody raised against a partial recombinant ZNF274.

This gene encodes a zinc finger protein containing five C2H2-type zinc finger domains, one or two Kruppel-associated box A (KRAB A) domains, and a leucine-rich domain. The encoded protein has been suggested to be a transcriptional repressor. It localizes predominantly to the nucleolus. Alternatively spliced transcript variants encoding different isoforms exist. These variants utilize alternative polyadenylation signals. [provided by RefSeq

Sequence: QKIDNPESQANSGALDTNQVLLHKIPPRKRLRKRDSQVKSMKHNSRVKIHQKSCERQKAKEGNGCRKTFSRSTKQITFIRIHKGSQVCRCSECGKIFRNPRYFSVHKKIHT

Specifications

Antigen zinc finger protein 274
Applications ELISA, Immunofluorescence
Classification Monoclonal
Clone 2F5
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant ZNF274.
Formulation PBS with no preservative; pH 7.4
Gene ZNF274
Gene Accession No. NM_133502
Gene Alias DKFZp686K08243/FLJ37843/HFB101/ZF2/ZKSCAN19
Gene Symbols ZNF274
Host Species Mouse
Immunogen ZNF274 (NP_598009, 420 a.a. ∼ 530 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity Purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Transcription Regulation
Whole Molecule Yes
Primary or Secondary Primary
Gene ID (Entrez) 10782
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Isotype IgG2b κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.