Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ubiquitin protein ligase E3 component n-recognin 3 (putative) (A01), Mouse anti-Human, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant ZNF650.

Manufacturer:  Abnova Corporation H00130507A01

Catalog No. 89-004-782


Add to cart

Description

Description

Sequence: MNKRIIEEICRKVTPPVPPKKVTAAEKKTLDKEERRQKARERQQKLLAEFASRQKSFMETAMDVDSPENDIPMEITTAEPQVSEAVYDCVICGQSGPSSEDRPTGLVVLL
Specifications

Specifications

ubiquitin protein ligase E3 component n-recognin 3 (putative)
Unconjugated
50% glycerol
NM_172070
DKFZp434P117|DKFZp686N10185|FLJ37422|KIAA2024|MGC126489|ZNF650
Mouse
50 uL
Ubiquitin/Proteasome
Y
Polyclonal
Human
ELISA, Western Blot
Mouse polyclonal antibody raised against a partial recombinant ZNF650.
UBR3
Serum
UBR3
ZNF650 (NP_742067, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag.
RUO
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Primary
130507
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit