Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89001551

IKAROS family zinc finger 4 (Eos), Mouse, Clone: 4E6, Abnova™

Catalog No. 89001551 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
200 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-001-551 200 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-001-551 Supplier Abnova Corporation Supplier No. H00064375M01A
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a partial recombinant IKZF4.

Members of the Ikaros (ZNFN1A1; MIM 603023) family of transcription factors, which includes Eos, are expressed in lymphocytes and are implicated in the control of lymphoid development.[supplied by OMIM

Sequence: DSRYLQLQLYLPSCSLLQGSGDSSLEKEFLGAPVGPSVSTPNSQHSSPSRSLSANSIKVEMYSDEESSRLLGPDERLLEKDDSVIVEDSLSEPLGYCDGSGPEPHSP

Specifications

Antigen IKAROS family zinc finger 4 (Eos)
Applications ELISA, Western Blot
Classification Monoclonal
Clone 4E6
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant IKZF4.
Formulation ascites with no preservative
Gene IKZF4
Gene Accession No. NM_022465
Gene Alias EOS/KIAA1782/ZNFN1A4
Gene Symbols IKZF4
Host Species Mouse
Immunogen IKZF4 (NP_071910, 2 a.a. ∼ 108 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Quantity 200 μL
Regulatory Status RUO
Research Discipline Transcription Regulation
Whole Molecule Yes
Primary or Secondary Primary
Gene ID (Entrez) 64375
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Ascites
Isotype IgM κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.