IKAROS family zinc finger 4 (Eos), Mouse, Clone: 4E6, Abnova™

Mouse monoclonal antibody raised against a partial recombinant IKZF4.

Supplier:  Abnova Corporation H00064375M01A

Catalog No. 89-001-551

Description

Members of the Ikaros (ZNFN1A1; MIM 603023) family of transcription factors, which includes Eos, are expressed in lymphocytes and are implicated in the control of lymphoid development.[supplied by OMIM

Sequence: DSRYLQLQLYLPSCSLLQGSGDSSLEKEFLGAPVGPSVSTPNSQHSSPSRSLSANSIKVEMYSDEESSRLLGPDERLLEKDDSVIVEDSLSEPLGYCDGSGPEPHSP

Specifications

• Antigen: IKAROS family zinc finger 4 (Eos)
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: ascites with no preservative
• Gene Accession No.: NM_022465
• Gene Symbols: IKZF4
• Immunogen: IKZF4 (NP_071910, 2 a.a. ∼ 108 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Regulatory Status: RUO
• Whole Molecule: Yes
• Gene ID (Entrez): 64375
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Ascites

• Applications: ELISA, Western Blot
• Clone: 4E6
• Description: Mouse monoclonal antibody raised against a partial recombinant IKZF4.
• Gene: IKZF4
• Gene Alias: EOS/KIAA1782/ZNFN1A4
• Host Species: Mouse
• Quantity: 200 μL
• Research Discipline: Transcription Regulation
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody
• Isotype: IgM κ