Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
AP1S3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00
Specifications
Antigen | AP1S3 |
---|---|
Dilution | Immunohistochemistry 1:20 - 1:50, Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:20 - 1:50 |
Applications | Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Description
AP1S3 Polyclonal antibody specifically detects AP1S3 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)Specifications
AP1S3 | |
Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
Unconjugated | |
Rabbit | |
Human | |
Adapter-Related Protein Complex 1 Subunit Sigma-1C, Adaptor Protein Complex AP-1 Sigma-1C Subunit, Adaptor Protein Complex AP-1 Subunit Sigma-1C, Adaptor-Related Protein Complex 1 Subunit Sigma-1C, Adaptor-Related Protein Complex 1, Sigma 3 Subunit, Clathrin Assembly Protein Complex 1 Sigma-1C Small Chain, Golgi Adaptor HA1/AP1 Adaptin Sigma-1C Subunit, PSORS15, Sigma 1C Subunit Of AP-1 Clathrin, Sigma1C-Adaptin | |
This antibody was developed against a recombinant protein corresponding to amino acids: ERKKITREIVQIILSRGHRTSSFVDWKELKLVYKRY | |
Primary | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Immunohistochemistry 1:20 - 1:50, Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
Polyclonal | |
Purified | |
RUO | |
PBS (pH 7.2), 40% Glycerol | |
130340 | |
IgG | |
Immunogen affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title