Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
AP2M1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP25586025UL
Description
AP2M1 Polyclonal specifically detects AP2M1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
AP2M1 | |
Polyclonal | |
Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL | |
Adaptin-mu2, adaptor-related protein complex 2, mu 1 subunit, AP-2 mu chain, Clathrin assembly protein complex 2 medium chain, clathrin coat adaptor protein AP50, Clathrin coat assembly protein AP50, Clathrin coat-associated protein AP50, clathrin-associated/assembly/adaptor protein, medium 1, HA2 50 kDa subunit, KIAA0109, mu subunit, Plasma membrane adaptor AP-2 50 kDa protein, plasma membrane adaptor AP-2 50kDA protein | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. |
Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
AP2M1 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LLMSPQGQVLSAHVSGRVVMKSYLSGMPECKFGMNDKIVIEKQGKGTADETSKSGKQSIAIDDCTF | |
25 μL | |
Signal Transduction | |
1173 | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction