Invitrogen™ AP2M1 Polyclonal Antibody

Rabbit Polyclonal Antibody

Supplier:  Invitrogen™ PA595390

Catalog No. PIPA595390

Description

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human U2OS whole cell, human MCF-7 whole cell, rat kidney tissue. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

The heterotetrameric coat assembly protein complex, also known as the adaptor-related protein complex 2 (AP-2), belongs to the adaptor complexes medium subunits family. The mu 1 subunit of the AP-2 complex (AP2M1) is required for the activity of a vacuolar ATPase, which is responsible for proton pumping occurring in the acidification of endosomes and lysosomes. AP2M1 has also been shown to associate with the HIV-1 protein Nef, suggesting that Nef may use AP-2 complex to enhance the rate of endocytosis of both CD4 and class I MHC. AP2M1 may also play an important role in regulating the intracellular trafficking and function of cytotoxic T-lymphocyte associated (CTLA)-4 protein. At least two isoforms of AP2M1 are known to exist.

Specifications

• Antigen: AP2M1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Gene: AP2M1
• Gene Alias: adapter-related protein complex 2 mu subunit; adapter-related protein complex 2 subunit mu; adaptin-mu2; Adaptor protein complex AP-2 subunit mu; adaptor related protein complex 2 mu 1 subunit; adaptor related protein complex 2 subunit mu 1; adaptor related protein complex 2, mu 1 subunit; adaptor-related protein complex 2 subunit mu; adaptor-related protein complex 2, mu 1 subunit; AP-2 complex subunit mu; AP-2 mu 2 chain; AP-2 mu chain; Ap2m1; AP50; Clapm1; clathrin adaptor complex AP2, mu subunit; Clathrin assembly protein complex 2 medium chain; clathrin assembly protein complex 2 mu medium chain; clathrin coat adaptor protein AP50; Clathrin coat assembly protein AP50; Clathrin coat-associated protein AP50; clathrin-associated/assembly/adaptor protein, medium 1; coat assembly protein complex 50 kD; HA2 50 kDA subunit; KIAA0109; mu2; Mu2-adaptin; Plasma membrane adaptor AP-2 50 kDa protein; plasma membrane adaptor AP-2 50kDA protein; QtsA-16673; unnamed protein product
• Host Species: Rabbit
• Purification Method: Affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 116563, 1173, 11773
• Content And Storage: -20°C
• Form: Lyophilized

• Applications: Western Blot
• Concentration: 500 μg/mL
• Formulation: PBS with 4mg trehalose and 0.05mg sodium azide
• Gene Accession No.: P84091, P84092, Q96CW1
• Gene Symbols: AP2M1
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human AP2M1 (399-435aa LKVRYLKVFEPKLNYSDHDVIKWVRYIGRSGIYETRC).
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Product Type: Antibody
• Isotype: IgG

Safety and Handling

WARNING: Cancer - www.P65Warnings.ca.gov