AP3B1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Catalog Number	Mfr. No.	Quantity
NB430834	Novus Biologicals NBP18922825UL	25 μL
NBP189228	Novus Biologicals NBP189228	0.1 mL

Description

AP3B1 Polyclonal specifically detects AP3B1 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: AP3B1
• Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 8546
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:VISVSTPAFVPTKTHVLLHRMSGKGLAAHYFFPRQPCIFGDKMVSIQITLNNTTDRKIENIHIGEKKLPIGMKMHVFNPIDSLEPEGS
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Dilution: Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:20 - 1:50
• Classification: Polyclonal
• Host Species: Rabbit
• Target Species: Human
• Gene Alias: Adapter-related protein complex 3 subunit beta-1, Adaptor protein complex AP-3 subunit beta-1, adaptor-related protein complex 3, beta 1 subunit, ADTB3, ADTB3APE, AP-3 complex subunit beta-1, beta-3A-adaptin, beta3A-adaptin, Clathrin assembly protein complex 3 beta-1 large chain, HPS, HPS2AP-3 complex beta-3A subunit
• Gene Symbols: AP3B1
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

For Research Use Only