Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
AP3M2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP156624
Description
AP3M2 Polyclonal specifically detects AP3M2 in Human samples. It is validated for Western Blot.Specifications
AP3M2 | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
Adapter-related protein complex 3 mu-2 subunit, adaptor-related protein complex 3, mu 2 subunit, AP-3 complex subunit mu-2, AP47B, CLA20, Clathrin assembly protein assembly protein complex 1 medium chain homolog 2, Clathrin coat assembly protein AP47 homolog 2, Clathrin coat-associated protein AP47 homolog 2, clathrin-associated protein AP47 homolog 2, Golgi adaptor AP-1 47 kDa protein homolog 2, HA1 47 kDa subunit homolog 2, HA1 47kDA subunit homolog 2, mu3B-adaptin, P47B | |
Rabbit | |
47 kDa | |
100 μL | |
Primary | |
This product is specific to Subunit or Isoform: mu-2. | |
Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish | |
IgG |
Western Blot | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml | |
P53677 | |
AP3M2 | |
Synthetic peptides corresponding to AP3M2(adaptor-related protein complex 3, mu 2 subunit) The peptide sequence was selected from the middle region of AP3M2 (NP_006794). Peptide sequence VVNTITGSTNVGDQLPTGQLSVVPWRRTGVKYTNNEAYFDVIEEIDAIID. | |
Affinity purified | |
RUO | |
10947 | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction