Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. AP3M2 Antibody, Novus Biologicals™

AP3M2 Antibody, Novus Biologicals™
SDP

Catalog No. NBP156624 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP156624 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP156624 Supplier Novus Biologicals Supplier No. NBP156624
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

AP3M2 Polyclonal specifically detects AP3M2 in Human samples. It is validated for Western Blot.

Specifications

Antigen AP3M2
Applications Western Blot
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. P53677
Gene Alias Adapter-related protein complex 3 mu-2 subunit, adaptor-related protein complex 3, mu 2 subunit, AP-3 complex subunit mu-2, AP47B, CLA20, Clathrin assembly protein assembly protein complex 1 medium chain homolog 2, Clathrin coat assembly protein AP47 homolog 2, Clathrin coat-associated protein AP47 homolog 2, clathrin-associated protein AP47 homolog 2, Golgi adaptor AP-1 47 kDa protein homolog 2, HA1 47 kDa subunit homolog 2, HA1 47kDA subunit homolog 2, mu3B-adaptin, P47B
Gene Symbols AP3M2
Host Species Rabbit
Immunogen Synthetic peptides corresponding to AP3M2(adaptor-related protein complex 3, mu 2 subunit) The peptide sequence was selected from the middle region of AP3M2 (NP_006794). Peptide sequence VVNTITGSTNVGDQLPTGQLSVVPWRRTGVKYTNNEAYFDVIEEIDAIID.
Molecular Weight of Antigen 47 kDa
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 10947
Test Specificity This product is specific to Subunit or Isoform: mu-2.
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.