Invitrogen™ APC2 Polyclonal Antibody

Catalog No.	Quantity
PIPA595377	100 μg

Catalog No. PIPA595377 Supplier Invitrogen™ Supplier No. PA595377

Description

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: HELA whole cell. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

Cell cycle regulated protein ubiquitination and degradation within subcellular domains is thought to be essential for the normal progression of mitosis. APC2 is a highly conserved component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin ligase that controls progression through mitosis and the G1 phase of the cell cycle. APC/C is responsible for degrading anaphase inhibitors, mitotic cyclins, and spindle-associated proteins ensuring that events of mitosis take place in proper sequence. The individual APC/C components mRNA and protein levels are expressed at approximately the same levels in most tissues and cell lines, suggesting that they perform their functions as part of a complex. Like APC11, APC2 contains cullin and RING finger domains that are thought to be important in regulating ubiquitination activity.

Specifications

• Antigen: APC2
• Applications: Western Blot
• Classification: Polyclonal
• Concentration: 500 μg/mL
• Conjugate: Unconjugated
• Formulation: PBS with 4mg trehalose and 0.05mg sodium azide
• Gene: APC2
• Gene Accession No.: O95996
• Gene Alias: 9230107K09Rik; adenomatosis polyposis coli 2; adenomatous polyposis coli like; adenomatous polyposis coli protein 2; Adenomatous polyposis coli protein-like; AI852447; AL024279; Anapc2; anaphase promoting complex subunit 2; anaphase-promoting complex subunit 2; APC2; APC2, WNT signaling pathway regulator; APCL; APC-like; Cyclosome subunit 2; EGK_07151; Emi4; expressed during mesenchymal induction 4; Imi4; induced during mesenchymal induction 4; KIAA1406; mKIAA1406; R75424
• Gene Symbols: APC2
• Host Species: Rabbit
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human APC2 (51-90aa KHLQGKLEQEARVLVSSGQTEVLEQLKALQMDITSLYNLK).
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 10297
• Target Species: Human
• Content And Storage: -20°C
• Product Type: Antibody
• Form: Lyophilized
• Isotype: IgG