Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Apc7 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | Apc7 |
---|---|
Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
Apc7 Polyclonal specifically detects Apc7 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
Apc7 | |
Polyclonal | |
Rabbit | |
Q9UJX3 | |
51434 | |
Synthetic peptides corresponding to ANAPC7(anaphase promoting complex subunit 7) The peptide sequence was selected from the C terminal of ANAPC7 (NP_057322). Peptide sequence ALSLDPNDQKSLEGMQKMEKEESPTDATQEEDVDDMEGSGEEGDLEGSDS. | |
Primary |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
RUO | |
anaphase promoting complex subunit 7, anaphase-promoting complex subunit 7, APC7Cyclosome subunit 7 | |
ANAPC7 | |
IgG | |
This product is specific to Subunit or Isoform: 7. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title