Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
APCDD1L Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$382.00
Specifications
| Antigen | APCDD1L |
|---|---|
| Dilution | Immunohistochemistry 1:2500 - 1:5000, Immunohistochemistry-Paraffin 1:2500 - 1:5000 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
APCDD1L Polyclonal antibody specifically detects APCDD1L in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
| APCDD1L | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Cellular Signaling | |
| PBS (pH 7.2), 40% Glycerol | |
| 164284 | |
| IgG | |
| Immunogen affinity purified |
| Immunohistochemistry 1:2500 - 1:5000, Immunohistochemistry-Paraffin 1:2500 - 1:5000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| Adenomatosis polyposis coli down-regulated 1 protein-like, adenomatosis polyposis coli down-regulated 1-like, FLJ90166, MGC126807, MGC126809, protein APCDD1-like, RP4-685L9.2 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: QPTFTVYAAGRYTRGTPSTRVRGGTELVFEVTRAHVTPMDQVTTAMLNFSEPSSCGGAGAWSMGTERDVTATNGCLPLGIRLPHVEYEL | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title