Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. APE Antibody, Novus Biologicals™

APE Antibody, Novus Biologicals™
SDP

Catalog No. NB435192 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB435192 25 μL
NBP276495 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB435192 Supplier Novus Biologicals Supplier No. NBP27649525UL
Only null left
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

APE Polyclonal specifically detects APE in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

Antigen APE
Applications Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunocytochemistry/Immunofluorescence 1-4 μg/mL
Formulation PBS, pH 7.2, containing 40% glycerol with 0.02% sodium azide
Gene Alias AP endonuclease 1, APE, APE1, APE-1, APEAPEX nuclease (multifunctional DNA repair enzyme), APENAP endonuclease class I, APEX deoxyribonuclease (apurinic or apyrimidinic), APEX nuclease, APEX nuclease (multifunctional DNA repair enzyme) 1, Apurinic-apyrimidinic endonuclease 1, APXAP lyase, DNA-(apurinic or apyrimidinic site) lyase, EC 3.1, EC 4.2.99.18, HAP1apurinic/apyrimidinic (abasic) endonuclease, multifunctional DNA repair enzyme, protein REF-1, redox factor 1, Redox factor-1, REF-1, REF1 apurinic/apyrimidinic exonuclease
Gene Symbols APEX1
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: DKEGYSGVGLLSRQCPLKVSYGIGEEEHDQEGRVIVAEFDSFVLVTAYVPNAGRGLVRLEYRQRWDEAFRKFLKGLASRKPLVLCGDLNVAHEEIDLRNPKGNKKNAGFTPQEGAPHR
Purification Method Affinity Purified
Quantity 25 μL
Research Discipline Autophagy, Base Excision Repair, Cancer, Core ESC Like Genes, DNA Repair, Stem Cell Markers
Primary or Secondary Primary
Gene ID (Entrez) 328.0
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.