Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

APE Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP276495

Catalog No. NBP276495


Add to cart

Description

Description

APE Polyclonal antibody specifically detects APE in Human samples. It is validated for Immunocytochemistry, Immunofluorescence.
Specifications

Specifications

APE
Unconjugated
PBS, pH 7.2, containing 40% glycerol with 0.02% sodium azide
AP endonuclease 1, APE, APE1, APE-1, APEAPEX nuclease (multifunctional DNA repair enzyme), APENAP endonuclease class I, APEX deoxyribonuclease (apurinic or apyrimidinic), APEX nuclease, APEX nuclease (multifunctional DNA repair enzyme) 1, Apurinic-apyrimidinic endonuclease 1, APXAP lyase, DNA-(apurinic or apyrimidinic site) lyase, EC 3.1, EC 4.2.99.18, HAP1apurinic/apyrimidinic (abasic) endonuclease, multifunctional DNA repair enzyme, protein REF-1, redox factor 1, Redox factor-1, REF-1, REF1 apurinic/apyrimidinic exonuclease
Rabbit
IgG
100 μL
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Polyclonal
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunocytochemistry, Immunofluorescence
Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
Affinity Purified
APEX1
This antibody was developed against Recombinant Protein corresponding to amino acids: DKEGYSGVGLLSRQCPLKVSYGIGEEEHDQEGRVIVAEFDSFVLVTAYVPNAGRGLVRLEYRQRWDEAFRKFLKGLASRKPLVLCGDLNVAHEEIDLRNPKGNKKNAGFTPQEGAPHR
Affinity purified
Autophagy, Base Excision Repair, Cancer, Core ESC Like Genes, DNA Repair, Stem Cell Markers
Primary
328.0
Human
SDS
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit