APEH Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication

Supplier:  Novus Biologicals NBP185333

Catalog No. NBP185333

Description

APEH Polyclonal specifically detects APEH in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: APEH
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Alias: AARE, ACPH, acylamino-acid-releasing enzyme, acylaminoacyl-peptidase, Acyl-peptide hydrolase, APH, D3F15S2, D3S48EEC 3.4.19.1, DNF15S2, MGC2178, N-acylaminoacyl-peptide hydrolase, OPH, Oxidized protein hydrolase
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: APEH
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:IDQDLMVAQFSTPSLPPTLKVGFLPSAGKEQSVLWVSLEEAEPIPDIHWGIRVLQPPPEQENVQYAGLDFEAILLQPGSPPDKTQVP
• Quantity: 0.1 mL
• Research Discipline: GPCR, Stem Cell Markers
• Gene ID (Entrez): 327
• Target Species: Human
• Isotype: IgG

For Research Use Only