Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

APOB Rabbit anti-Human, Polyclonal , Abnova™

APOB polyclonal antibody raised against recombinant human APOB.

Manufacturer:  Abnova Corporation PAB29501

Catalog No. 89-933-577


Add to cart

Description

Description

This gene product is the main apolipoprotein of chylomicrons and low density lipoproteins. It occurs in plasma as two main isoforms, apoB-48 and apoB-100: the former is synthesized exclusively in the gut and the latter in the liver. The intestinal and the hepatic forms of apoB are encoded by a single gene from a single, very long mRNA. The two isoforms share a common N-terminal sequence. The shorter apoB-48 protein is produced after RNA editing of the apoB-100 transcript at residue 2180 (CAA->UAA), resulting in the creation of a stop codon, and early translation termination. Mutations in this gene or its regulatory region cause hypobetalipoproteinemia, normotriglyceridemic hypobetalipoproteinemia, and hypercholesterolemia due to ligand-defective apoB, diseases affecting plasma cholesterol and apoB levels. [provided by RefSeq]

Sequence: NFVASHIANILNSEELDIQDLKKLVKEALKESQLPTVMDFRKFSRNYQLYKSVSLPSLDPASAKIEGNLIFDPNNYLPKESMLKTTLTAFGFASADLIE
Specifications

Specifications

APOB
Unconjugated
Immunofluorescence (1-4 ug/mL) Immunohistochemistry (1:500-1:1000) Western Blot (1:250-1:500) The optimal working dilution should be determined by the end user.
Liquid
APOB
Recombinant protein corresponding to amino acids of human APOB.
Antigen affinity purification
RUO
Primary
338
Immunofluorescence, Immunohistochemistry (PFA fixed), Western Blot
APOB polyclonal antibody raised against recombinant human APOB.
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
FLDB
Rabbit
IgG
100 uL
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Polyclonal
Human
SDS
Documents
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit