Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. APOBEC1 Antibody, Novus Biologicals™

APOBEC1 Antibody, Novus Biologicals™
SDP

Catalog No. NBP15726820 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP15726820 20 μL
NBP157268 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP15726820 Supplier Novus Biologicals Supplier No. NBP15726820UL

Description

Rabbit Polyclonal Antibody

APOBEC1 Polyclonal specifically detects APOBEC1 in Human samples. It is validated for Western Blot.

Specifications

Antigen APOBEC1
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000
Formulation PBS & 2% Sucrose. with No Preservative
Gene Accession No. P41238
Gene Alias APOBEC-1, apolipoprotein B mRNA editing enzyme, catalytic polypeptide 1, Apolipoprotein B mRNA-editing enzyme 1, BEDPC->U-editing enzyme APOBEC-1, CDAR1, EC 3.5.4, EC 3.5.4.-, HEPRapolipoprotein B mRNA editing enzyme complex-1
Gene Symbols APOBEC1
Host Species Rabbit
Immunogen Synthetic peptides corresponding to APOBEC1(apolipoprotein B mRNA editing enzyme, catalytic polypeptide 1) The peptide sequence was selected from the N terminal of APOBEC1. Peptide sequence TSEKGPSTGDPTLRRRIEPWEFDVFYDPRELRKEACLLYEIKWGMSRKI
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 339
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.