Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
APOBEC1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15726820UL
Description
APOBEC1 Polyclonal specifically detects APOBEC1 in Human samples. It is validated for Western Blot.Specifications
| APOBEC1 | |
| Polyclonal | |
| Western Blot 1:100-1:2000 | |
| P41238 | |
| APOBEC1 | |
| Synthetic peptides corresponding to APOBEC1(apolipoprotein B mRNA editing enzyme, catalytic polypeptide 1) The peptide sequence was selected from the N terminal of APOBEC1. Peptide sequence TSEKGPSTGDPTLRRRIEPWEFDVFYDPRELRKEACLLYEIKWGMSRKI | |
| 20 μL | |
| Primary | |
| Human | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS & 2% Sucrose. with No Preservative | |
| APOBEC-1, apolipoprotein B mRNA editing enzyme, catalytic polypeptide 1, Apolipoprotein B mRNA-editing enzyme 1, BEDPC->U-editing enzyme APOBEC-1, CDAR1, EC 3.5.4, EC 3.5.4.-, HEPRapolipoprotein B mRNA editing enzyme complex-1 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 339 | |
| Store at -20C. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction