Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

APOBEC3D Antibody, Novus Biologicals™
SDP

Catalog No. NB395820 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB395820 25 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NB395820 Supplier Novus Biologicals Supplier No. NBP24916825UL
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

APOBEC3D Polyclonal antibody specifically detects APOBEC3D in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

Antigen APOBEC3D
Applications Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
Formulation PBS (pH 7.2), 40% Glycerol
Gene Alias APOBEC3DE, APOBEC3E, apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3D, apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3D (putative), apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3E pseudogene, ARP6, DNA dC->dU-editing enzyme APOBEC-3D, EC 3.5.4, EC 3.5.4.-, probable DNA dC->dU-editing enzyme APOBEC-3D
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: VFRGPVLPKRQSNHRQEVYFRFENHAEMCF
Purification Method Immunogen affinity purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Cell Biology
Primary or Secondary Primary
Gene ID (Entrez) 140564
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.