Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
APOBEC3D Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP24916825UL
Description
APOBEC3D Polyclonal antibody specifically detects APOBEC3D in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
APOBEC3D | |
Polyclonal | |
Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
APOBEC3DE, APOBEC3E, apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3D, apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3D (putative), apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3E pseudogene, ARP6, DNA dC->dU-editing enzyme APOBEC-3D, EC 3.5.4, EC 3.5.4.-, probable DNA dC->dU-editing enzyme APOBEC-3D | |
This antibody was developed against a recombinant protein corresponding to amino acids: VFRGPVLPKRQSNHRQEVYFRFENHAEMCF | |
25 μL | |
Cell Biology | |
140564 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
IgG |
Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2), 40% Glycerol | |
Rabbit | |
Immunogen affinity purified | |
RUO | |
Primary | |
Human | |
Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction