Apolipoprotein A-I/ApoA1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Catalog Number	Mfr. No.	Quantity
NB397417	Novus Biologicals NBP23346825UL	25 μL
NBP233468	Novus Biologicals NBP233468	0.1 mL

Description

Apolipoprotein A-I/ApoA1 Polyclonal specifically detects Apolipoprotein A-I/ApoA1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Apolipoprotein A-I/ApoA1
• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Target Species: Human
• Gene Accession No.: P02647
• Gene ID (Entrez): 335
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: SKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKL
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Dilution: Western Blot 0.04 - 0.4 ug/ml, Immunohistochemistry 1:5000 - 1:10000, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:5000 - 1:10000
• Classification: Polyclonal
• Host Species: Rabbit
• Research Discipline: Breast Cancer, Cancer, Diabetes Research, Lipid and Metabolism
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: APOA1, apoA-I, Apo-AI, Apolipoprotein A1, apolipoprotein A-I, MGC117399
• Gene Symbols: APOA1
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

For Research Use Only