Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Apolipoprotein D Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
Antigen | Apolipoprotein D |
---|---|
Dilution | Immunohistochemistry-Paraffin 1:500 - 1:1000 |
Applications | Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Description
Apolipoprotein D Polyclonal specifically detects Apolipoprotein D in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
Apolipoprotein D | |
Immunohistochemistry (Paraffin) | |
Unconjugated | |
RUO | |
ApoD, Apo-D, apolipoprotein D | |
APOD | |
IgG | |
Affinity Purified |
Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
Polyclonal | |
Rabbit | |
Human | |
347 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:GKCPNPPVQENFDVNKYLGRWYEIEKIPTTFENGRCIQANYSLMENGKIKVLNQELRADGTVNQIEGE | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title