Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Apolipoprotein L1 Antibody (CL0171), Novus Biologicals™

Mouse Monoclonal Antibody

$382.00 - $610.00

Specifications

Antigen	Apolipoprotein L1
Clone	CL0171
Dilution	Western Blot 1:500-1:1000, Immunohistochemistry 1:2500 - 1:5000, Immunohistochemistry-Paraffin 1:2500-1:5000
Applications	Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification	Monoclonal

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NB437709 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP21478525UL	25ul	Each for $382.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

NBP214785 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP214785	0.1 mL	Each for $610.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

Apolipoprotein L1 Monoclonal specifically detects Apolipoprotein L1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen	Apolipoprotein L1
Dilution	Western Blot 1:500-1:1000, Immunohistochemistry 1:2500 - 1:5000, Immunohistochemistry-Paraffin 1:2500-1:5000
Classification	Monoclonal
Form	Purified
Regulatory Status	RUO
Gene Alias	ApoL, APO-L, ApoL-I, Apolipoprotein L, apolipoprotein L, 1, apolipoprotein L1, Apolipoprotein L-I, FSGS4
Gene Symbols	APOL1
Isotype	IgG1
Purification Method	Protein A purified
Test Specificity	Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

Clone	CL0171
Applications	Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate	Unconjugated
Host Species	Mouse
Target Species	Human
Gene ID (Entrez)	8542
Immunogen	This antibody was developed against Recombinant Protein corresponding to amino acids: SNFLSLAGNTYQLTRGIGKDIRALRRARANLQSVPHASASRPRVTEPISAESGEQVERVNEPSILEMSRGVKLTDVAPVSFFLVLDVVYLVYESKHLHEGAKSETAEELKKVAQELEEKLNILNN
Primary or Secondary	Primary
Content And Storage	Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

Apolipoprotein L1 Antibody (CL0171), Novus Biologicals™

Specifications

Description

Specifications

Documents