APRIN Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Catalog Number	Mfr. No.	Quantity
NB405621	Novus Biologicals NBP19012225UL	25 μL
NBP190122	Novus Biologicals NBP190122	0.1 mL

Description

APRIN Polyclonal specifically detects APRIN in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: APRIN
• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Target Species: Human, Mouse, Rat
• Gene Alias: Androgen-induced proliferation inhibitorKIAA0979androgen induced inhibitor of proliferation, Androgen-induced prostate proliferative shutoff-associated protein AS3, androgen-induced shutoff 3, AS3APRIN, CG008, FLJ23236, PDS5, regulator of cohesion maintenance, homolog B (S. cerevisiae), sister chromatid cohesion protein PDS5 homolog B
• Gene Symbols: PDS5B
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500
• Classification: Polyclonal
• Host Species: Rabbit
• Research Discipline: Apoptosis, Cell Cycle and Replication, DNA Repair
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 23047
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:GSQRSRKRGHTASESDEQQWPEEKRLKEDILENEDEQNSPPKKGKRGRPPKPLGGGTPKEEPTMKTSKKGSKKKSGPPAPEEEE
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only