Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
APXL Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$487.50
Specifications
| Antigen | APXL |
|---|---|
| Dilution | Western Blot 1.0 ug/ml |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
APXL Polyclonal specifically detects APXL in Human samples. It is validated for Western Blot.Specifications
| APXL | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Vision | |
| PBS buffer, 2% sucrose | |
| 357 | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot 1.0 ug/ml | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| apical protein, Xenopus laevis-like, apical protein-like (Xenopus laevis), Apical-like protein, APX homolog of Xenopus, APXLHSAPXL, DKFZp781J074, FLJ39277, Protein APXL, protein Shroom2, shroom family member 2 | |
| The immunogen is a synthetic peptide directed towards the middle region of human APXL (NP_001640). Peptide sequence CTSPPGLSYMKAKEKTVEDLKSEELAREIVGKDKSLADILDPSVKIKTTM | |
| Affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title