Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Aquaporin 1/AQP1 Antibody, Novus Biologicals™
SDP

Catalog No. NB432592 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB432592 25 μL
NBP184488 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB432592 Supplier Novus Biologicals Supplier No. NBP18448825UL
Only null left
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody has been used in 1 publication

Aquaporin 1/AQP1 Polyclonal specifically detects Aquaporin 1/AQP1 in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

Antigen Aquaporin 1/AQP1
Applications Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.4 ug/ml, Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:1000-1:2500
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias 28-kDa, AQP-1, AQP-CHIP, aquaporin 1 (channel-forming integral protein, 28kDa), aquaporin 1 (Colton blood group), Aquaporin-CHIP, CHIP2828kDa, CO blood group), CO, MGC26324
Gene Symbols AQP1
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:PRSSDLTDRVKVWTSGQVEEYDLDADDINSRVEMKPK
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 358
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human, Mouse
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.