Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ARC/ARG3.1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
Antigen | ARC/ARG3.1 |
---|---|
Applications | Immunocytochemistry, Immunofluorescence |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
ARC/ARG3.1 Polyclonal specifically detects ARC/ARG3.1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
ARC/ARG3.1 | |
Polyclonal | |
Rabbit | |
Apoptosis, Neuroscience, Sensory Systems | |
activity-regulated cytoskeleton-associated protein, ARC/ARG3.1, KIAA0278Arg3.1Activity-regulated gene 3.1 protein homolog | |
ARC | |
IgG | |
Affinity Purified |
Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
RUO | |
Human | |
23237 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:ESTGGKYPVGSESARHTVSVGVGGPESYCHEADGYDYTVSPYAITPPPAAGELPGQEPAEAQQYQPWVPGEDGQPSPGVDTQIFEDPREFLS | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title