Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Archaemetzincin 2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP18599625UL
Description
Archaemetzincin 2 Polyclonal specifically detects Archaemetzincin 2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
Archaemetzincin 2 | |
Polyclonal | |
Western Blot 0.4 ug/ml, Immunohistochemistry 1:500-1:1000, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:500-1:1000 | |
Q86W34 | |
AMZ2 | |
This antibody was developed against Recombinant Protein corresponding to amino acids:AGEQRLMNEAFQPASDLFGPITLHSPSDWITSHPEAPQDFEQFFSDPYRKTPSPNKRSIYIQSIGSLGNTRIIS | |
Affinity Purified | |
RUO | |
51321 | |
Human | |
IgG |
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
archaelysin family metallopeptidase 2, archaemetzincin-2, archaemetzincins-2, Archeobacterial metalloproteinase-like protein 2, EC 3.- | |
Rabbit | |
41 kDa | |
25 μL | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction