Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Archaemetzincin 2 Rabbit anti-Rat, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP310636100UL
Description
Archaemetzincin 2 Polyclonal specifically detects Archaemetzincin 2 in Rat samples. It is validated for Western Blot.Specifications
| Archaemetzincin 2 | |
| Polyclonal | |
| Western Blot 1.0 ug/ml | |
| archaelysin family metallopeptidase 2, archaemetzincin-2, archaemetzincins-2, Archeobacterial metalloproteinase-like protein 2, EC 3.- | |
| The immunogen is a synthetic peptide directed towards the middle region of Rat Archaemetzincin 2 (NP_001014143). Peptide sequence ITLHSQSDWISSHPEAPQDFEQFFSDRYRKAPCPKKHIIYIQPIGFLGNT | |
| 100 μg | |
| Primary | |
| Rat | |
| Purified |
| Western Blot | |
| Unconjugated | |
| PBS buffer, 2% sucrose | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 51321 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction