Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Invitrogen™ Arg3.1 Polyclonal Antibody
GREENER_CHOICE

Rabbit Polyclonal Antibody

Supplier:  Invitrogen™ PA595315

Catalog No. PIPA595315


Only null left
Add to Cart

Description

Description

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human U20S whole cell,human 293T whole cell,human SH-SY5Y whole cell,human SiHa whole cell,rat brain tissue,rat C6 whole cell,mouse brain tissue,mouse Neuro-2a whole cell . Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

Master regulator of synaptic plasticity that self-assembles into virion-like capsids that encapsulate RNAs and mediate intercellular RNA transfer in the nervous system. ARC protein is released from neurons in extracellular vesicles that mediate the transfer of ARC mRNA into new target cells, where ARC mRNA can undergo activity-dependent translation. ARC capsids are endocytosed and are able to transfer ARC mRNA into the cytoplasm of neurons. Acts as a key regulator of synaptic plasticity: required for protein synthesis-dependent forms of long-term potentiation (LTP) and depression (LTD) and for the formation of long-term memory. Regulates synaptic plasticity by promoting endocytosis of AMPA receptors (AMPARs) in response to synaptic activity: this endocytic pathway maintains levels of surface AMPARs in response to chronic changes in neuronal activity through synaptic scaling, thereby contributing to neuronal homeostasis. Acts as a postsynaptic mediator of activity-dependent synapse elimination in the developing cerebellum by mediating elimination of surplus climbing fiber synapses. Accumulates at weaker synapses, probably to prevent their undesired enhancement. This suggests that ARC-containing virion-like capsids may be required to eliminate synaptic material. Required to transduce experience into long-lasting changes in visual cortex plasticity and for long-term memory. Involved in postsynaptic trafficking and processing of amyloid-beta A4 (APP) via interaction with PSEN1. In addition to its role in synapses, also involved in the regulation of the immune system: specifically expressed in skin-migratory dendritic cells and regulates fast dendritic cell migration, thereby regulating T-cell activation.
TRUSTED_SUSTAINABILITY
Specifications

Specifications

Arg3.1
Polyclonal
Unconjugated
Arc
activity regulated cytoskeletal-associated protein; activity regulated cytoskeleton associated protein; activity-regulated cytoskeleton-associated protein; Activity-regulated gene 3.1 protein; activity-regulated gene 3.1 protein homolog; Arc; arc {ECO:0000312; ARC/ARG3.1; Arc3.1; arg3.1; Arg3.1/ARC; C86064; Growth factor ARC; hArc; KIAA0278; mArc; rg3.1; RGD:62037}
Rabbit
Affinity chromatography
RUO
11838, 23237, 54323
-20°C
Lyophilized
Western Blot, Immunocytochemistry
500 μg/mL
PBS with 5mg BSA and 0.05mg sodium azide
Q63053, Q7LC44, Q9WV31
Arc
A synthetic peptide corresponding to a sequence at the C-terminus of human Arc (332-366aa KLKRFLRHPLPKTLEQLIQRGMEVQDDLEQAAEPA).
100 μg
Primary
Human, Mouse, Rat
Antibody
IgG
Product Suggestions

Product Suggestions

Videos
Safety and Handling

Safety and Handling

WARNING: Cancer - www.P65Warnings.ca.gov
SDS
Documents

Documents

Product Certifications
Promotions

Promotions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Your feedback has been submitted: Thank you for helping us improve our website.